Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Post-GPI attachment to proteins factor 2 (PGAP2)

This Recombinant Human Post-GPI attachment to proteins factor 2 (PGAP2) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 2, FGF receptor-activating protein 1

UniProt

Q9UHJ9

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYQVPLPLDRDGTLVRLRFTMVALVTVCCPLVAFLFCILWSLLFHFKETTATHCGATPCR MFSAASQPLDPDGTLFRLRFTAMVWWAITFPVFGFFFCIIWSLVFHFEYTVATDCGVPNY LPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSPCSCYRPLCRLNFGL NVVENLALLVLTYVSSSEDFTIHENAFIVFIASSLGHMLLTCILWRLTKKHTVSQEDRKS YSWKQRLFIINFISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFG NKELLITSQPEEKRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Intelectin-1 HDR Plasmid (h)
sc-405402-HDR 20 µg

Intelectin-1 HDR Plasmid (h)

Sign In for Pricing
View Details
Rabbit Polyclonal Rabbit anti-Guinea Pig IgG1 Secondary Antibody (Azide Free)
NBP2-69515 1 mL

Rabbit Polyclonal Rabbit anti-Guinea Pig IgG1 Secondary Antibody (Azide Free)

Sign In for Pricing
View Details
Preformed DMPC 100nm Plain PEGylated Liposomes
B2019508 5 mL

Preformed DMPC 100nm Plain PEGylated Liposomes

Sign In for Pricing
View Details
RNAP-σ interaction inhibitor-1
T207529-01 10 mg

RNAP-σ interaction inhibitor-1

Sign In for Pricing
View Details
RNAP-σ interaction inhibitor-1
T207529-02 50 mg

RNAP-σ interaction inhibitor-1

Sign In for Pricing
View Details
PSMC3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9F3]
TA500922AM 100 µL

PSMC3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9F3]

Sign In for Pricing
View Details