Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein YneF (yneF)

This Recombinant Escherichia coli Uncharacterized protein YneF (yneF) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Uncharacterized protein YneF

UniProt

P76147

Expression Region

1-315

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLADWFSEQFSTGVLIVPCMLTLAIPGVLPRFKAEQMMPAIALIVSVIASVVIGGAGSLA FPLPALIWCAVRYTPQVTCLLTFVTGAVEIVLVANSVIDISVGSPFSIPQMFSARLGIAT MAICPIMVSFSVAAINSLMKQVALRADFDFLTQVYSRSGLYEALKSPSLKQTQHLTVMLL DIDYFKSINDNYGHECGDKVLSVFARHIQKIVGDKGLVARMGGEEFAVAVPSVNPVDGLL MAEKIRKGVELQPFTWQQKTLYLTVSIGVGSGRASYLTLTDDFNKLMVEADTCLYRSKKD GRNRTSTMRYGEEVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRS-1 (E306) polyclonal antibody
BS3590-01 50 µL

IRS-1 (E306) polyclonal antibody

Sign In for Pricing
View Details
IRS-1 (E306) polyclonal antibody
BS3590-02 100 µL

IRS-1 (E306) polyclonal antibody

Sign In for Pricing
View Details
(+) -Apogossypol 5mg
A16316-5 5 mg

(+) -Apogossypol 5mg

Sign In for Pricing
View Details
Hsa-miR-12135 agomir
HY-R00110A-01 5 nmol

Hsa-miR-12135 agomir

Sign In for Pricing
View Details
Hsa-miR-12135 agomir
HY-R00110A-02 20 nmol

Hsa-miR-12135 agomir

Sign In for Pricing
View Details
Cytokine Like Protein 1 (CYTL1) Magnetic Fluorescence Assay Kit
MBS2161067-01 96 Tests

Cytokine Like Protein 1 (CYTL1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details