Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus sanguinis Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Streptococcus sanguinis Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

A3CL57

Expression Region

1-316

Origin

Streptococcus sanguinis (strain SK36)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLIAIFLAVLLDWLIGDPYSWPHPVKWMGSYIYLCMRLQEKKQFSPYLFGFFLWLTTVG LALGVSCGLLWLAGLAHPVLYWLVWIYLAYASLAAKSLAFEAQKVYHTLKFGTLEEARKQ VGMIVGRETSQLTPEEISKATIETVAENTSDGVIGPLLCLFLGGPILAMTYKAINTLDSM VGYKTEKYRKIGLISAKMDDLANLIPARLTWLFLILSSQILLLDVKGALRIGWRDRYQHA SPNSAFSEAVVAGALGIQLGGPHVYHGELIEKPTIGEDSRPVEADDIQTAISLLYTSTMT GLILFTLFYLVMQAYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G protein coupled receptor 30 (GPER1) Human Gene Knockout Kit (CRISPR)
KN203027RB 1 Kit

G protein coupled receptor 30 (GPER1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sodium Fluorophosphate
TRC-S627500-5G 5 g

Sodium Fluorophosphate

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (PASE/4LJ), CF568 conjugate, 0.1mg/mL
BNC681473-100 1x 100 µL

Prostate Specific Acid Phosphatase (PSAP) (PASE/4LJ), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNase-I Polyclonal Antibody
D-AB-10417L-01 25 µL

DNase-I Polyclonal Antibody

Sign In for Pricing
View Details
DNase-I Polyclonal Antibody
D-AB-10417L-02 100 µL

DNase-I Polyclonal Antibody

Sign In for Pricing
View Details
M6PR Polyclonal Antibody
E-AB-62820-01 60 µL

M6PR Polyclonal Antibody

Sign In for Pricing
View Details