Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqhQ (yqhQ)

This Recombinant Bacillus subtilis Uncharacterized protein yqhQ (yqhQ) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Uncharacterized protein yqhQ

UniProt

P54515

Expression Region

1-318

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKHKVPPAYGGQAVVEGVMFGGKHHYVTAIRRTDGSIDFFKLPRKHNPKLNIVKKIPFL RGIAAIIEASANGTKHLNFSSERYGLDPSEDETLEQEEKKSSGLSMYLSLAVIGVLSFLF SKFVFTLVPVFLAELTRPIFSLNTAQIAIESLFKLILLLGYIYFLSMTPLIKRVFQYHGA EHKVINCYEQNLPITVENVQNQSRLHYRCGSSFILFTIIVGMFVYLLVPTDPLWLRVIDR VALIPVVLGISFEVLQLTNKVRDIPGLKLLGYPGLWLQLLTTKEPKDEQVEVAIESFNEL LRLEALSEQNQKPSHNVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wash Buffer 0.05% in Tween 20, pH 8.0
42320004-1 500 mL

Wash Buffer 0.05% in Tween 20, pH 8.0

Sign In for Pricing
View Details
GC Column, H1-CarboWax 20M, 30m*0.53mm*1.33μm, 1pc/pk
14011372 1 PC

GC Column, H1-CarboWax 20M, 30m*0.53mm*1.33μm, 1pc/pk

Sign In for Pricing
View Details
Anti-OMA1 Antibody Picoband® Biotin Conjugated
A06260-Biotin 100 µg/Vial

Anti-OMA1 Antibody Picoband® Biotin Conjugated

Sign In for Pricing
View Details
Recombinant Aeromonas Hydrophila hscA Protein
VAng-Lsx0755-inquire Inquire

Recombinant Aeromonas Hydrophila hscA Protein

Sign In for Pricing
View Details
Mouse Monoclonal SMCO1 Antibody (OTI1H6) [DyLight 488]
NBP2-74238G 0.1 mL

Mouse Monoclonal SMCO1 Antibody (OTI1H6) [DyLight 488]

Sign In for Pricing
View Details
IFLTD1 Recombinant Protein (Mouse)
RP143039 100 µg

IFLTD1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details