Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqhQ (yqhQ)

This Recombinant Bacillus subtilis Uncharacterized protein yqhQ (yqhQ) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Uncharacterized protein yqhQ

UniProt

P54515

Expression Region

1-318

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKHKVPPAYGGQAVVEGVMFGGKHHYVTAIRRTDGSIDFFKLPRKHNPKLNIVKKIPFL RGIAAIIEASANGTKHLNFSSERYGLDPSEDETLEQEEKKSSGLSMYLSLAVIGVLSFLF SKFVFTLVPVFLAELTRPIFSLNTAQIAIESLFKLILLLGYIYFLSMTPLIKRVFQYHGA EHKVINCYEQNLPITVENVQNQSRLHYRCGSSFILFTIIVGMFVYLLVPTDPLWLRVIDR VALIPVVLGISFEVLQLTNKVRDIPGLKLLGYPGLWLQLLTTKEPKDEQVEVAIESFNEL LRLEALSEQNQKPSHNVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNF-4α (H-1) AC
sc-374229 AC 500 µg/mL - 25% ag

HNF-4α (H-1) AC

Sign In for Pricing
View Details
Human LZTS2 Pre-designed siRNA Set B
SI009070B 1 Each

Human LZTS2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
RBBP6 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-1483R-PerCP-Cy5.5 100 µL

RBBP6 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
POLR2J,1-117aa, Human, His tag, E.coli
E53A03464 50 µg

POLR2J,1-117aa, Human, His tag, E.coli

Sign In for Pricing
View Details
Neurotrophin 3 Polyclonal Antibody, Cy3 Conjugated
bs-41378R-Cy3 100 µL

Neurotrophin 3 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
SMARCA2/BRM Rabbit Polyclonal Antibody (Biotin)
orb2608786 100 µg

SMARCA2/BRM Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details