Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqhQ (yqhQ)

This Recombinant Bacillus subtilis Uncharacterized protein yqhQ (yqhQ) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Uncharacterized protein yqhQ

UniProt

P54515

Expression Region

1-318

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKHKVPPAYGGQAVVEGVMFGGKHHYVTAIRRTDGSIDFFKLPRKHNPKLNIVKKIPFL RGIAAIIEASANGTKHLNFSSERYGLDPSEDETLEQEEKKSSGLSMYLSLAVIGVLSFLF SKFVFTLVPVFLAELTRPIFSLNTAQIAIESLFKLILLLGYIYFLSMTPLIKRVFQYHGA EHKVINCYEQNLPITVENVQNQSRLHYRCGSSFILFTIIVGMFVYLLVPTDPLWLRVIDR VALIPVVLGISFEVLQLTNKVRDIPGLKLLGYPGLWLQLLTTKEPKDEQVEVAIESFNEL LRLEALSEQNQKPSHNVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3 (Complement Component 3) BioAssayTM ELISA Kit (Guinea pig) discontinued
354377-01 48 Tests

C3 (Complement Component 3) BioAssayTM ELISA Kit (Guinea pig) discontinued

Sign In for Pricing
View Details
C3 (Complement Component 3) BioAssayTM ELISA Kit (Guinea pig) discontinued
354377-02 96 Tests

C3 (Complement Component 3) BioAssayTM ELISA Kit (Guinea pig) discontinued

Sign In for Pricing
View Details
Dendronobiloside D
orb3127341 5 mg

Dendronobiloside D

Sign In for Pricing
View Details
Human TSSK4 qPCR Primer Pair
QH70885S 200 Tests

Human TSSK4 qPCR Primer Pair

Sign In for Pricing
View Details
Dermal Fibroblast RNA (HDF RNA), Neonatal
106-R25n 25 µg

Dermal Fibroblast RNA (HDF RNA), Neonatal

Sign In for Pricing
View Details
Rabbit Monoclonal Influenza A nucleoprotein Antibody (010) [Biotin]
NBP3-12741B 100 µL

Rabbit Monoclonal Influenza A nucleoprotein Antibody (010) [Biotin]

Sign In for Pricing
View Details