Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

A1JTR6

Expression Region

1-318

Origin

Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLSAWFVAFLLDHWLGDPPRWPHPVRWMGNLITLLQRAIRTLCHSEWALKWGGAVLWLL VVGITWLVSWGFLWLMTEINPWLGWLAQVWMIYTLLAGRCLSDAALAVFDALQHGTLAQS REKLSWIVGRDTSQLEKPQITRAVVETVAENSVDGVIAPLFFLMLGGAPLAMAYKAVNTL DSMVGYKTPKYRAIGYMSARMDDLANWLPARLSWVLLSAAAWLIQADYRQALRIGWRDRY QHSSPNCAWSEATVAGALGIRLGGPNDYCGERVEKPWIGDERREVALSDIPRSIHLMMMA SLLALLLFALTHLLLVGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-100 1x 100 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF568 conjugate, 0.1mg/mL
BNC680960-500 1x 500 µL

MUC1 / EMA / CD227 (Epithelial Marker) (rMUC1/960), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF568 conjugate, 0.1mg/mL
BNC681619-100 1x 100 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (100/D5), CF568 conjugate, 0.1mg/mL
BNC680045-100 1x 100 µL

Bcl-2 (100/D5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (CR1/802), CF488A conjugate, 0.1mg/mL
BNC880802-100 1x 100 µL

CD35 / CR1 (CR1/802), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details