Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Citrobacter koseri Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

A8AEP3

Expression Region

1-319

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVLAWCIAWLLDFVIGDPQNWPHPVRWIGNLISATQRVVRRYCHSDRSLRIGGAVMWLV VVGVTWAVSWGVLALASEIHPWFGWLVEIWMIFTVLAGRCLANAARDVERPLRAGDLAES REKLSWIVGRDTSQLQPEQVNRAVVETVAENTVDGIIAPLFFLFLGGAPLAMAYKAVNTL DSMVGYKHEKYRAIGMVSARLDDIANVIPARLSWLLLSIAAALCRYDGYRALHIGWRDRY NHSSPNCAWSEASVAGALGIRLGGPNDYFGERVEKPWIGDAQRGISVDDISRTIRLMWVA STLALALFIAVRCLLVGAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC17A3 Peptide
MBS3231262-01 0.1 mg

SLC17A3 Peptide

Sign In for Pricing
View Details
SLC17A3 Peptide
MBS3231262-02 5x 0.1 mg

SLC17A3 Peptide

Sign In for Pricing
View Details
PCDHB15 antibody
70R-19145 50 μL

PCDHB15 antibody

Sign In for Pricing
View Details
Rat High molecular weight Adiponectin ELISA Kit
MBS743935-01 48 Well

Rat High molecular weight Adiponectin ELISA Kit

Sign In for Pricing
View Details
Rat High molecular weight Adiponectin ELISA Kit
MBS743935-02 96 Well

Rat High molecular weight Adiponectin ELISA Kit

Sign In for Pricing
View Details
Rat High molecular weight Adiponectin ELISA Kit
MBS743935-03 5x 96 Well

Rat High molecular weight Adiponectin ELISA Kit

Sign In for Pricing
View Details