Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium sp. Protease HtpX homolog (htpX)

This Recombinant Rhizobium sp. Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

C3MAR8

Expression Region

1-319

Origin

Rhizobium sp. (strain NGR234)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLVRTAMLLAFMTALFMAVGYVIGGRGGMMIALLMAAGMNFFSYWNSDRMVLRMYRAQE VDERDAPEYYGIVRDLATNAGLPMPRVYVIDSPQPNAFATGRNPQNAAVAASTGLLQSLS YEEVAGVMAHELAHIQYRDTLTMTLTATLAGAISMLGNFAFFFGGNRDNNNPLGFVGVLI AMIVAPFAAMLVQMAISRTREYSADRRGAEICGNPLSLASALRKIAGAAHAIPNYDAERN PATAHMFIINPLSGERMDNLFSTHPNTENRVAALERMAREMSAGSTAPARPDNAVRRSRS VPKTGWGRGGSEPPKGPWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-100 1x 100 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
BNC940679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (CLIP/813), CF405S conjugate, 0.1mg/mL
BNC040813-100 1x 100 µL

CD74 (CLIP/813), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calbindin 1 (CALB1) (CALB1/2782), CF740 conjugate, 0.1mg/mL
BNC742782-100 1x 100 µL

Calbindin 1 (CALB1) (CALB1/2782), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF405S conjugate, 0.1mg/mL
BNC042207-100 1x 100 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), Biotin conjugate, 0.1mg/mL
BNCB0324-500 1x 500 µL

CD53 (161-2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details