Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella choleraesuis Cobalamin biosynthesis protein CbiB (cbiB)

This Recombinant Salmonella choleraesuis Cobalamin biosynthesis protein CbiB (cbiB) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CbiB

UniProt

Q57MW3

Expression Region

1-319

Origin

Salmonella choleraesuis (strain SC-B67)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMILAWCIAWVLDFIIGDPQHWPHPVRWIGRLITFVQRIVRRYCPGDKALRIGGGVMWVV VVGATWGVAWGVLALAQRIHPWFGWSVEVWMIFTTLAGRSLARAAQEVERPLRENDLAES RIKLSWIVGRDTSQLQPAQINRAVVETVAENTVDGIIAPLFFLFLGGAPLAMAYKAVNTL DSMVGYKHEKYRAIGMVSARMDDVANYLPARLSWLLLGIAAGLCRLSGWRALRIGWRDRY NHSSPNCAWSEACVAGALGIQLGGPNNYFGERVDKPWIGDAQRDISVDDISRTIRLMWVA STLALALFIAARCGLSGLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-500 1x 500 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-500 1x 500 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-100 1x 100 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-100 1x 100 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details