Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photorhabdus luminescens subsp. laumondii Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Photorhabdus luminescens subsp. laumondii Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

Q7N2S6

Expression Region

1-319

Origin

Photorhabdus luminescens subsp. laumondii (strain TT01)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLAAWFAAFLLDSWLGDPPHWPHPVRWIGKLISLVQRAVRRCCHSERALKVGGAGLWIV VVGLTWLVSWGCLWLMNAIHPWVGWLVEVWMIYTLLAGRCLSDTALEVHGVLQQGLLDES RQQLSWIVGRDTSQLDAPQITRAVVETVAENSVDGVIAPLFFLMIGGAPLAMAYKAINTL DSMVGYKTQEYHAIGYVSARMDDLANWLPARLSWLLLSAAAWFIRLDFRQALRIGWRDRY QHTSPNCGWSEATVAGALGIRLGGPSCYFGERVEKPWMGDERRKIALTDIPLSIYLMMIA SQLALLLFALLRLLLVGMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF594 conjugate, 0.1mg/mL
BNC940164-100 1x 100 µL

CD28 (204.12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-100 1x 100 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-500 1x 500 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF740 conjugate, 0.1mg/mL
BNC740449-100 1x 100 µL

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details