Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Dual oxidase maturation factor 2 (Duoxa2)

This Recombinant Mouse Dual oxidase maturation factor 2 (Duoxa2) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Dual oxidase maturation factor 2

UniProt

Q9D311

Expression Region

1-320

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAWDGVLPFYPQPRHAASFSVPLLIVILVFLSLAASFLFILPGIRGHSRWFWLVRVLLS LFIGAEIVAVHFSGDWFVGRVWTNTSYKAFSPSRVQVHVGLHVGLAGVNITLRGTPRQQL NETIDYNERFTWRLNEDYTKEYVHALEKGLPDPVLYLAEKFTPSSPCGLYHQYHLAGHYA AATLWVAFCFWIIANALLSMPAPLYGGLALLTTGAFTLFGVFAFASISSVPLCHFRLGSA VLTPYYGASFWLTLATGILSLLLGGAVVILHYTRPSALRSFLDLSVKDCSNQAKGNSPLT LNNPQHEQLKSPDLNITTLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin (Hyb8), CF568 conjugate, 0.1mg/mL
BNC680400-100 1x 100 µL

Biotin (Hyb8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2789), CF568 conjugate, 0.1mg/mL
BNC682789-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2789), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ENO3 Polyclonal Antibody
E-AB-52747-01 20 µL

ENO3 Polyclonal Antibody

Sign In for Pricing
View Details
ENO3 Polyclonal Antibody
E-AB-52747-02 60 µL

ENO3 Polyclonal Antibody

Sign In for Pricing
View Details
ENO3 Polyclonal Antibody
E-AB-52747-03 120 µL

ENO3 Polyclonal Antibody

Sign In for Pricing
View Details
ENO3 Polyclonal Antibody
E-AB-52747-04 200 µL

ENO3 Polyclonal Antibody

Sign In for Pricing
View Details