Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dual oxidase maturation factor 2 (DUOXA2)

This Recombinant Human Dual oxidase maturation factor 2 (DUOXA2) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Dual oxidase maturation factor 2, Dual oxidase activator 2

UniProt

Q1HG44

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLWNGVLPFYPQPRHAAGFSVPLLIVILVFLALAASFLLILPGIRGHSRWFWLVRVLLS LFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARVRLLVGLEGINITLTGTPVHQL NETIDYNEQFTWRLKENYAAEYANALEKGLPDPVLYLAEKFTPSSPCGLYHQYHLAGHYA SATLWVAFCFWLLSNVLLSTPAPLYGGLALLTTGAFALFGVFALASISSVPLCPLRLGSS ALTTQYGAAFWVTLATGVLCLFLGGAVVSLQYVRPSALRTLLDQSAKDCSQERGGSPLIL GDPLHKQAALPDLKCITTNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Histone H3 (mono methyl K14) Antibody
RC-16377-01 50 μL

Recombinant Histone H3 (mono methyl K14) Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 (mono methyl K14) Antibody
RC-16377-02 100 µL

Recombinant Histone H3 (mono methyl K14) Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 (mono methyl K14) Antibody
RC-16377-03 1 mL

Recombinant Histone H3 (mono methyl K14) Antibody

Sign In for Pricing
View Details
TNF alpha (TNF656), CF640R conjugate, 0.1mg/mL
BNC400656-500 1x 500 µL

TNF alpha (TNF656), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CPSF2 (NM_017437) Human Recombinant Protein
TP309857L 1 mg

CPSF2 (NM_017437) Human Recombinant Protein

Sign In for Pricing
View Details
SLC39A5 Mouse Monoclonal Antibody [Clone ID: OTI2F2]
CF810144 100 µg

SLC39A5 Mouse Monoclonal Antibody [Clone ID: OTI2F2]

Sign In for Pricing
View Details