Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-32 (TSPAN32)

This Recombinant Human Tetraspanin-32 (TSPAN32) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Tetraspanin-32, Tspan-32, Protein Phemx

UniProt

Q96QS1

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPWSRVRVAKCQMLVTCFFILLLGLSVATMVTLTYFGAHFAVIRRASLEKNPYQAVHQW AFSAGLSLVGLLTLGAVLSAAATVREAQGLMAGGFLCFSLAFCAQVQVVFWRLHSPTQVE DAMLDTYDLVYEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLDRKGKYTLTPR ACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHR ALQGRSRGGLSGCPERGLSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMCX3, CT (ARMCX3, ALEX3, Armadillo repeat-containing X-linked protein 3, ARM protein lost in epithelial cancers on chromosome X 3) (AP) discontinued
032090-AP 200 µL

ARMCX3, CT (ARMCX3, ALEX3, Armadillo repeat-containing X-linked protein 3, ARM protein lost in epithelial cancers on chromosome X 3) (AP) discontinued

Sign In for Pricing
View Details
Mouse anti-Ionotropic Glutamate receptor 1 antibody ELISA Kit
MBS7273807-01 48 Well

Mouse anti-Ionotropic Glutamate receptor 1 antibody ELISA Kit

Sign In for Pricing
View Details
Mouse anti-Ionotropic Glutamate receptor 1 antibody ELISA Kit
MBS7273807-02 96 Well

Mouse anti-Ionotropic Glutamate receptor 1 antibody ELISA Kit

Sign In for Pricing
View Details
Mouse anti-Ionotropic Glutamate receptor 1 antibody ELISA Kit
MBS7273807-03 5x 96 Well

Mouse anti-Ionotropic Glutamate receptor 1 antibody ELISA Kit

Sign In for Pricing
View Details
Mouse anti-Ionotropic Glutamate receptor 1 antibody ELISA Kit
MBS7273807-04 10x 96 Well

Mouse anti-Ionotropic Glutamate receptor 1 antibody ELISA Kit

Sign In for Pricing
View Details
Phospho-LC3B Antibody (pT93/Y99)
F48639-0.4ML 0.4 mL

Phospho-LC3B Antibody (pT93/Y99)

Sign In for Pricing
View Details