Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-32 (TSPAN32)

This Recombinant Human Tetraspanin-32 (TSPAN32) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Tetraspanin-32, Tspan-32, Protein Phemx

UniProt

Q96QS1

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPWSRVRVAKCQMLVTCFFILLLGLSVATMVTLTYFGAHFAVIRRASLEKNPYQAVHQW AFSAGLSLVGLLTLGAVLSAAATVREAQGLMAGGFLCFSLAFCAQVQVVFWRLHSPTQVE DAMLDTYDLVYEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLDRKGKYTLTPR ACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHR ALQGRSRGGLSGCPERGLSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Integrin Beta 4 (ITGb4)
MBS2055200-01 0.1 mL

PE-Linked Polyclonal Antibody to Integrin Beta 4 (ITGb4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Integrin Beta 4 (ITGb4)
MBS2055200-02 0.2 mL

PE-Linked Polyclonal Antibody to Integrin Beta 4 (ITGb4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Integrin Beta 4 (ITGb4)
MBS2055200-03 0.5 mL

PE-Linked Polyclonal Antibody to Integrin Beta 4 (ITGb4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Integrin Beta 4 (ITGb4)
MBS2055200-04 1 mL

PE-Linked Polyclonal Antibody to Integrin Beta 4 (ITGb4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Integrin Beta 4 (ITGb4)
MBS2055200-05 5 mL

PE-Linked Polyclonal Antibody to Integrin Beta 4 (ITGb4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Integrin Beta 4 (ITGb4)
MBS2055200-06 5x 5 mL

PE-Linked Polyclonal Antibody to Integrin Beta 4 (ITGb4)

Sign In for Pricing
View Details