Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-32 (TSPAN32)

This Recombinant Human Tetraspanin-32 (TSPAN32) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Tetraspanin-32, Tspan-32, Protein Phemx

UniProt

Q96QS1

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGPWSRVRVAKCQMLVTCFFILLLGLSVATMVTLTYFGAHFAVIRRASLEKNPYQAVHQW AFSAGLSLVGLLTLGAVLSAAATVREAQGLMAGGFLCFSLAFCAQVQVVFWRLHSPTQVE DAMLDTYDLVYEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLDRKGKYTLTPR ACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHR ALQGRSRGGLSGCPERGLSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hexdc (NM_001001333) Mouse Tagged Lenti ORF Clone
MR207466L3 10 µg

Hexdc (NM_001001333) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PARP1, Phosphorylated (S782) (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD(+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 405)
MBS6330928-01 0.1 mL

PARP1, Phosphorylated (S782) (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD(+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 405)

Sign In for Pricing
View Details
PARP1, Phosphorylated (S782) (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD(+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 405)
MBS6330928-02 5x 0.1 mL

PARP1, Phosphorylated (S782) (PARP1, ADPRT, PPOL, Poly [ADP-ribose] polymerase 1, ADP-ribosyltransferase diphtheria toxin-like 1, NAD(+) ADP-ribosyltransferase 1, Poly[ADP-ribose] synthase 1) (MaxLight 405)

Sign In for Pricing
View Details
Cross Linked C-Telopeptide Of Type I Collagen (CTXI) Polyclonal Antibody
CAU35470-01 100 µL

Cross Linked C-Telopeptide Of Type I Collagen (CTXI) Polyclonal Antibody

Sign In for Pricing
View Details
Cross Linked C-Telopeptide Of Type I Collagen (CTXI) Polyclonal Antibody
CAU35470-02 200 µL

Cross Linked C-Telopeptide Of Type I Collagen (CTXI) Polyclonal Antibody

Sign In for Pricing
View Details
Cross Linked C-Telopeptide Of Type I Collagen (CTXI) Polyclonal Antibody
CAU35470-03 1 mL

Cross Linked C-Telopeptide Of Type I Collagen (CTXI) Polyclonal Antibody

Sign In for Pricing
View Details