Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 2W5 (OR2W5)

This Recombinant Human Putative olfactory receptor 2W5 (OR2W5) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Putative olfactory receptor 2W5

UniProt

A6NFC9

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKDNASYLQAFILVGSSDRPGLEKILFAVILIFCILTLVGNTAIILLLVMDVRLHTPMY FFLGNLSFLDLCFTASIAPQLLWNLGGPEKTITYHGCVAQLYIYMMLGSTECVLLVVMSH DRYVAVCRSLHYMAVMRPHLCLQLVTVAWCCGFLNSFIMCPQTMQLSRCGRRRVDHFLCE MPALIAMSCEETMLVEAIHLCPGGGSPPGAALPHPHLLWRDCSRGAEDEVSSRAKESLPH LLFSPHSGLSLLRNHHLRVPEAGQQLLPRSGEVPDSLLHHRHSQHQPPHLHFEEQGCEGD HEETSGVGERGWGASTRGTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuropeptide FF Receptor 2 (NPFF-2R) (291-308) (Human) - Antibody
H-001-59 100 µL

Neuropeptide FF Receptor 2 (NPFF-2R) (291-308) (Human) - Antibody

Sign In for Pricing
View Details
Lentiviral human EFCAB12 shRNA (UAS) - Lentiviral human EFCAB12 shRNA (UAS, GFP) plasmid
GTR15345145 1 Vial

Lentiviral human EFCAB12 shRNA (UAS) - Lentiviral human EFCAB12 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Canine Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL) ELISA Kit
201-15-0021 96 Tests

Canine Tumor Necrosis Factor Related Apoptosis Inducing Ligand (TRAIL) ELISA Kit

Sign In for Pricing
View Details
Cadherin-9 Polyclonal Antibody
MBS2538279-01 0.02 mL

Cadherin-9 Polyclonal Antibody

Sign In for Pricing
View Details
Cadherin-9 Polyclonal Antibody
MBS2538279-02 0.06 mL

Cadherin-9 Polyclonal Antibody

Sign In for Pricing
View Details
Cadherin-9 Polyclonal Antibody
MBS2538279-03 0.12 mL

Cadherin-9 Polyclonal Antibody

Sign In for Pricing
View Details