Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative Golgi pH regulator C (GPR89C)

This Recombinant Human Putative Golgi pH regulator C (GPR89C) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Putative Golgi pH regulator C, Protein GPR89C

UniProt

A6NKF9

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFLGILSIEQLISRVGVIGVTLMALLSGFGAVNCPYTYMSYFLRNVTDTDILALERRLLQ TMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALE ELSRQLFLETADLYATKERIEYSKTFKGKYFNFLGYFFSIYCVWKIFMATINIVFDRVGK TDPVTRGIEITVNYLGIQFDVKFWSQHISFILVGIIIVTSIRGLLITLTKFFYAISSSKS SNVIVLLLAQIMGMYFVSSVLLIRMSMPLEYRTIITEVLGELQFNFYHRWFDVIFLVSAL SSILFLYLAHKQAPEKQMAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DBR1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
17692151 3x 1.0 µg DNA

DBR1 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
GAK (NM_001286833) Human Tagged ORF Clone
RC240047 10 µg

GAK (NM_001286833) Human Tagged ORF Clone

Sign In for Pricing
View Details
Timeless (G-4) : m-IgG2a BP-HRP Bundle
sc-546969 1 Kit

Timeless (G-4) : m-IgG2a BP-HRP Bundle

Sign In for Pricing
View Details
GR (Phospho-Ser203) Antibody
MBS8585306-01 0.1 mg

GR (Phospho-Ser203) Antibody

Sign In for Pricing
View Details
GR (Phospho-Ser203) Antibody
MBS8585306-02 0.1 mL (AF405L)

GR (Phospho-Ser203) Antibody

Sign In for Pricing
View Details
GR (Phospho-Ser203) Antibody
MBS8585306-03 0.1 mL (AF405S)

GR (Phospho-Ser203) Antibody

Sign In for Pricing
View Details