Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative Golgi pH regulator C (GPR89C)

This Recombinant Human Putative Golgi pH regulator C (GPR89C) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Putative Golgi pH regulator C, Protein GPR89C

UniProt

A6NKF9

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFLGILSIEQLISRVGVIGVTLMALLSGFGAVNCPYTYMSYFLRNVTDTDILALERRLLQ TMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALE ELSRQLFLETADLYATKERIEYSKTFKGKYFNFLGYFFSIYCVWKIFMATINIVFDRVGK TDPVTRGIEITVNYLGIQFDVKFWSQHISFILVGIIIVTSIRGLLITLTKFFYAISSSKS SNVIVLLLAQIMGMYFVSSVLLIRMSMPLEYRTIITEVLGELQFNFYHRWFDVIFLVSAL SSILFLYLAHKQAPEKQMAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NEURL4 shRNA Plasmid
abx963488-01 150 µg

Human NEURL4 shRNA Plasmid

Sign In for Pricing
View Details
Human NEURL4 shRNA Plasmid
abx963488-02 300 µg

Human NEURL4 shRNA Plasmid

Sign In for Pricing
View Details
GENLISA™ Human Sequestosome - 1 (P62/SQSTM1) ELISA
KBH21886 1x 96 Well

GENLISA™ Human Sequestosome - 1 (P62/SQSTM1) ELISA

Sign In for Pricing
View Details
Normal rat IgG2b Alexa Fluor® 680
sc-516666 200 µg/mL

Normal rat IgG2b Alexa Fluor® 680

Sign In for Pricing
View Details
Nup98 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4204603 1.0 µg DNA

Nup98 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Polyclonal LANCL2 Antibody
NBP1-83339 0.1 mL

Rabbit Polyclonal LANCL2 Antibody

Sign In for Pricing
View Details