Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative Golgi pH regulator C (GPR89C)

This Recombinant Human Putative Golgi pH regulator C (GPR89C) spans the amino acid sequence from region 1-320.

Product Specifications

Product Name Alternative

Putative Golgi pH regulator C, Protein GPR89C

UniProt

A6NKF9

Expression Region

1-320

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFLGILSIEQLISRVGVIGVTLMALLSGFGAVNCPYTYMSYFLRNVTDTDILALERRLLQ TMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALE ELSRQLFLETADLYATKERIEYSKTFKGKYFNFLGYFFSIYCVWKIFMATINIVFDRVGK TDPVTRGIEITVNYLGIQFDVKFWSQHISFILVGIIIVTSIRGLLITLTKFFYAISSSKS SNVIVLLLAQIMGMYFVSSVLLIRMSMPLEYRTIITEVLGELQFNFYHRWFDVIFLVSAL SSILFLYLAHKQAPEKQMAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SHIP Antibody (SHIP-01) [mFluor Violet 450 SE]
NB110-81538MFV450 0.1 mL

Mouse Monoclonal SHIP Antibody (SHIP-01) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
NCK2   monoclonal antibody
MB11270 50ul

NCK2 monoclonal antibody

Sign In for Pricing
View Details
Lentiviral mouse Ano2 shRNA (UAS) - Lentiviral mouse Ano2 shRNA (UAS, iRFP) plasmid
GTR15232060 1 Vial

Lentiviral mouse Ano2 shRNA (UAS) - Lentiviral mouse Ano2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
NDE1 Human qPCR Primer Pair (NM_001143979)
HP234282 200 Reactions

NDE1 Human qPCR Primer Pair (NM_001143979)

Sign In for Pricing
View Details
Pimasertib
B1698-25 25 mg

Pimasertib

Sign In for Pricing
View Details
Pcdha5 sgRNA CRISPR Lentivector set (Rat)
K7430501 3x 1.0 µg

Pcdha5 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details