Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant High osmolarity signaling protein SHO1A (SHO1A)

This Recombinant High osmolarity signaling protein SHO1A (SHO1A) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

High osmolarity signaling protein SHO1A, Osmosensor SHO1A

UniProt

D6PVB4

Expression Region

1-321

Origin

Hortaea werneckii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYNNNRYGGGGGGSKFNLGHIVGDPFSLATIAIATAGWLIAFVSSIIANIDQEYPNYSW WALAYMFFVILGVTFAVAANAVYTYHVAMVGFLAAGLVFTTSSVNSLIYWSDKAKQAAAA GFILLSMVSIVWIFYFGSQPTASHRQTIDSFALHKDHAPSRASRHMTQSYRPETTHSAQH PQMYNSSQLAGFETSSPVTGYPGGAAGATKRESASAFPPPGQGGNFSNNQQPNPITSQNN PQNQHQQPQDLTSPSTTQQPTEYPYRAKAIYSYEANPDDANEISFNKHEILEVSDVSGRW WQAKKENGETGIAPSNYLILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-500 1x 500 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-500 1x 500 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P34 / cdk1 (POH-1), CF640R conjugate, 0.1mg/mL
BNC400853-100 1x 100 µL

P34 / cdk1 (POH-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (KRT10/844), CF647 conjugate, 0.1mg/mL
BNC470844-100 1x 100 µL

Cytokeratin 10 (KRT10/844), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details