Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens Protease HtpX homolog (htpX)

This Recombinant Agrobacterium tumefaciens Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

Q8UBM5

Expression Region

1-321

Origin

Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNMMRTAMLLAFMTALFMGVGFLIGGKGGMMIALLIAAGMNLFSYWNSDKMVLSAYRARE IDEANAPEFFHMIRDLSQNAGLPMPKVYIYDSPQPNAFATGRNPENAAVAASTGLLERLT PEEVAGVMAHELAHVQNRDTLTMTITATLAGAISMLGNFAFFFGGNRENNNNPLGFIGVL VAMIVAPLAAMLVQMAISRTREYSADRRGAEICGNPLWLASALQKISGMAQQIHNDDAER NPATAHMFIINPLSGERMDNLFSTHPNTENRVAALHAMAQEFSPRASTPPPSGDRPVRKS GSVPTTGWRRGNENERKGPWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-100 1x 100 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-100 1x 100 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF740 conjugate, 0.1mg/mL
BNC742289-100 1x 100 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (Leukocyte Marker) (K4B5), CF594 conjugate, 0.1mg/mL
BNC941680-100 1x 100 µL

CD45RA (Leukocyte Marker) (K4B5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF568 conjugate, 0.1mg/mL
BNC682474-100 1x 100 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details