Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sideroflexin-3 (Sfxn3)

This Recombinant Mouse Sideroflexin-3 (Sfxn3) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Sideroflexin-3

UniProt

Q91V61

Expression Region

1-321

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDLPLNINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGEQLEASRNIVQNYRAGVATP GLTEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQ WVNQSFNAIVNYSNRSGDAPITVQQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVP FAAVAAANCINIPLMRQRELQVGIPVTDEAGQRLGHSVTAAKQGIFQVVISRIGMAIPAM AIPPVIMNTLEKKDFLKRRPWLGAPLQVGLVGFCLVFATPLCCALFPQRSSIHVTRLEPE LRAQIQAQNPSIDVVYYNKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ESAM Protein (aa 1-248, Fc Tag)
PKSH031782 100 µg

Recombinant Human ESAM Protein (aa 1-248, Fc Tag)

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3291), CF568 conjugate, 0.1mg/mL
BNC683291-100 1x 100 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3291), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UBE1C Rabbit Polyclonal Antibody
R1706-14 100 µL

UBE1C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Diethyl Disulfide
TRC-D444315-5G 5 g

Diethyl Disulfide

Sign In for Pricing
View Details
General Purpose Oven BOGP-204
BOGP-204 1 Unit

General Purpose Oven BOGP-204

Sign In for Pricing
View Details
Bdp1 Mouse Gene Knockout Kit (CRISPR)
KN502129 1 Kit

Bdp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details