Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sideroflexin-3 (Sfxn3)

This Recombinant Mouse Sideroflexin-3 (Sfxn3) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Sideroflexin-3

UniProt

Q91V61

Expression Region

1-321

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDLPLNINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGEQLEASRNIVQNYRAGVATP GLTEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQ WVNQSFNAIVNYSNRSGDAPITVQQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVP FAAVAAANCINIPLMRQRELQVGIPVTDEAGQRLGHSVTAAKQGIFQVVISRIGMAIPAM AIPPVIMNTLEKKDFLKRRPWLGAPLQVGLVGFCLVFATPLCCALFPQRSSIHVTRLEPE LRAQIQAQNPSIDVVYYNKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Eotaxin 1 Antibody Pair Set
E-KAB-0598 50 µL & 100 µg

Mouse Eotaxin 1 Antibody Pair Set

Sign In for Pricing
View Details
CD82 Mouse Monoclonal Antibody [Clone ID: C33]
AM26701PU-N 100 µg

CD82 Mouse Monoclonal Antibody [Clone ID: C33]

Sign In for Pricing
View Details
Nicotine-d3 N-(4-Deoxy-4,5-didehydro)-Beta-D-glucuronide
TRC-N414255-1MG 1 mg

Nicotine-d3 N-(4-Deoxy-4,5-didehydro)-Beta-D-glucuronide

Sign In for Pricing
View Details
PEX1 (Center) Rabbit Polyclonal Antibody
AP53258PU-N 400 µL

PEX1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRMT2 Goat Polyclonal Antibody
AP33502PU-N 100 µg

PRMT2 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Brk (PTK6) Rabbit Polyclonal Antibody
TA361318 100 µL

Brk (PTK6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details