Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sideroflexin-1 (Sfxn1)

This Recombinant Mouse Sideroflexin-1 (Sfxn1) spans the amino acid sequence from region 2-322.

Product Specifications

Product Name Alternative

Sideroflexin-1

UniProt

Q99JR1

Expression Region

2-322

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGEVPPNINIKEPRWDQSTFIGRASHFFTVTDPRNILLTNEQLENARKVVHDYRQGIVPA GLTENELWRAKYAYDSAFHPDTGEKMTLIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQ WINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKRVSPLIGRFVP FAAVAAANCINIPLMRQRELKVGIPVTDENGTRLGESTNAAKQAITQVVISRILMAAPGM AIPPFIMNTLEKKAFLKRFPWMSAPIQVTLVGFCLVFATPLCCALFPQKSSMSVTSLEDE LQASIQRTHPEIRRVYFNKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2S1 Rabbit Monoclonal Antibody
E56G1795 100 µL

AP2S1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human Urotensin 2 (UTS2) ELISA Kit
MBS283073-01 48 Tests

Human Urotensin 2 (UTS2) ELISA Kit

Sign In for Pricing
View Details
Human Urotensin 2 (UTS2) ELISA Kit
MBS283073-02 96 Tests

Human Urotensin 2 (UTS2) ELISA Kit

Sign In for Pricing
View Details
Human Urotensin 2 (UTS2) ELISA Kit
MBS283073-03 5x 96 Tests

Human Urotensin 2 (UTS2) ELISA Kit

Sign In for Pricing
View Details
Human Urotensin 2 (UTS2) ELISA Kit
MBS283073-04 10x 96 Tests

Human Urotensin 2 (UTS2) ELISA Kit

Sign In for Pricing
View Details
AdmiRa-hsa-mir-5696 Virus
mh1423 250 µL

AdmiRa-hsa-mir-5696 Virus

Sign In for Pricing
View Details