Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Sideroflexin-3 (Sfxn3)

This Recombinant Rat Sideroflexin-3 (Sfxn3) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Sideroflexin-3

UniProt

Q9JHY2

Expression Region

1-321

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDLPLNINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGKQLEASRNIVQNYRAGVVTP GLTEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQ WVNQSFNAIVNYSNRSGDAPITVQQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVP FAAVAAANCINIPLMRQRELQVGIPVTDEAGQRLGHSVTAAKQGIFQVVVSRIGMAIPAM AIPPVIMNTLEKKDFLKRRPWLGAPLQVGLVGFCLVFATPLCCALFPQRSSIHVTRLEPE LRAQIQAQKPSIDVVYYNKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-100 1x 100 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-100 1x 100 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1469), CF594 conjugate, 0.1mg/mL
BNC941469-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/1469), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (NFL/736), CF488A conjugate, 0.1mg/mL
BNC880736-100 1x 100 µL

Neurofilament (NF-L) (NFL/736), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (MYC909), CF488A conjugate, 0.1mg/mL
BNC880909-100 1x 100 µL

C-Myc (MYC909), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details