Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction delta-2 protein (GJD2)

This Recombinant Human Gap junction delta-2 protein (GJD2) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Gap junction delta-2 protein, Connexin-36, Cx36, Gap junction alpha-9 protein

UniProt

Q9UKL4

Expression Region

1-321

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILIVAIVGETVYDDEQTMFVCNTLQP GCNQACYDRAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSAKQRERRYSTVFLALDRDP PESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSG LRTASKSKLRRQEGISRFYIIQVVFRNALEIGFLVGQYFLYGFSVPGLYECNRYPCIKEV ECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKLAVRGAQAKRKSIYEIRNK DLPRVSVPNFGRTQSSDSAYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDHHC17 siRNA (Human)
MBS8239172-01 15 nmol

ZDHHC17 siRNA (Human)

Sign In for Pricing
View Details
ZDHHC17 siRNA (Human)
MBS8239172-02 30 nmol

ZDHHC17 siRNA (Human)

Sign In for Pricing
View Details
ZDHHC17 siRNA (Human)
MBS8239172-03 5x 30 nmol

ZDHHC17 siRNA (Human)

Sign In for Pricing
View Details
C17orf87 Rabbit pAb, PerCP-Cy7 conjugated
orb2889287 100 µL

C17orf87 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
HESRG Rabbit Polyclonal Antibody
orb1879742-01 30 µL

HESRG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HESRG Rabbit Polyclonal Antibody
orb1879742-02 50 µL

HESRG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details