Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Sideroflexin-3 (SFXN3)

This Recombinant Bovine Sideroflexin-3 (SFXN3) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Sideroflexin-3

UniProt

A6QP55

Expression Region

1-321

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGELPLDINIQEPRWDQRTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGIVTP GLTEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLIFYRKTPTVVFWQ WLNQSFNAVVNYSNRSGDAPITVRQLGMAYVSATTGAVATALGLKSLTKHLPPLVGRFVP FAAVAAANCINIPLMRQRELQVGIPVTNEQGQRLGHSVAAAKKGIFQVVISRICMAIPAM AIPPVIMDTLEKKDFLKRRPWLGAPLQMGLVGFCLVFATPLCCALFPQRSSIHVSRLEPE LRAQIQEQNPSIEVVYYNKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF640R conjugate, 0.1mg/mL
BNC400175-500 1x 500 µL

CD46 (122.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-500 1x 500 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-500 1x 500 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-100 1x 100 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-500 1x 500 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details