Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction delta-2 protein (Gjd2)

This Recombinant Mouse Gap junction delta-2 protein (Gjd2) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Gap junction delta-2 protein, Connexin-36, Cx36, Gap junction alpha-9 protein

UniProt

O54851

Expression Region

1-321

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILIVAIVGETVYDDEQTMFVCNTLQP GCNQACYDRAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSAKQRERRYSTVFLALDRDP AESIGGPGGTGGGGSGGSKREDKKLQNAIVNGVLQNTETTSKETEPDCLEVKELTPHPSG LRTAARSKLRRQEGISRFYIIQVVFRNALEIGFLVGQYFLYGFSVPGLYECNRYPCIKEV ECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKLAVRGAQAKRKSVYEIRNK DLPRVSVPNFGRTQSSDSAYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxaceprol
MBS5758196 Inquire

Oxaceprol

Sign In for Pricing
View Details
Axin 2 Antibody (YA7253, Rabbit)
HY-P87569 1 Each

Axin 2 Antibody (YA7253, Rabbit)

Sign In for Pricing
View Details
ATG14, NT (ATG14, KIAA0831, Beclin 1-associated autophagy-related key regulator, Autophagy-related protein 14-like protein) (AP)
MBS6276007-01 0.2 mL

ATG14, NT (ATG14, KIAA0831, Beclin 1-associated autophagy-related key regulator, Autophagy-related protein 14-like protein) (AP)

Sign In for Pricing
View Details
ATG14, NT (ATG14, KIAA0831, Beclin 1-associated autophagy-related key regulator, Autophagy-related protein 14-like protein) (AP)
MBS6276007-02 5x 0.2 mL

ATG14, NT (ATG14, KIAA0831, Beclin 1-associated autophagy-related key regulator, Autophagy-related protein 14-like protein) (AP)

Sign In for Pricing
View Details
DOLK sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0625606 1.0 µg DNA

DOLK sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
D-Glucose 6-phosphate disodium salt
M33594-01 100 mg

D-Glucose 6-phosphate disodium salt

Sign In for Pricing
View Details