Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction delta-2 protein (Gjd2)

This Recombinant Mouse Gap junction delta-2 protein (Gjd2) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Gap junction delta-2 protein, Connexin-36, Cx36, Gap junction alpha-9 protein

UniProt

O54851

Expression Region

1-321

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILIVAIVGETVYDDEQTMFVCNTLQP GCNQACYDRAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSAKQRERRYSTVFLALDRDP AESIGGPGGTGGGGSGGSKREDKKLQNAIVNGVLQNTETTSKETEPDCLEVKELTPHPSG LRTAARSKLRRQEGISRFYIIQVVFRNALEIGFLVGQYFLYGFSVPGLYECNRYPCIKEV ECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKLAVRGAQAKRKSVYEIRNK DLPRVSVPNFGRTQSSDSAYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella flexneri serotype 5b 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)
MBS1378719-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)
MBS1378719-02 0.02 mg (Yeast)

Recombinant Shigella flexneri serotype 5b 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)
MBS1378719-03 0.1 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)
MBS1378719-04 0.1 mg (Yeast)

Recombinant Shigella flexneri serotype 5b 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)
MBS1378719-05 0.02 mg (Baculovirus)

Recombinant Shigella flexneri serotype 5b 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)
MBS1378719-06 0.02 mg (Mammalian-Cell)

Recombinant Shigella flexneri serotype 5b 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD)

Sign In for Pricing
View Details