Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction delta-2 protein (Gjd2)

This Recombinant Mouse Gap junction delta-2 protein (Gjd2) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Gap junction delta-2 protein, Connexin-36, Cx36, Gap junction alpha-9 protein

UniProt

O54851

Expression Region

1-321

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILIVAIVGETVYDDEQTMFVCNTLQP GCNQACYDRAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSAKQRERRYSTVFLALDRDP AESIGGPGGTGGGGSGGSKREDKKLQNAIVNGVLQNTETTSKETEPDCLEVKELTPHPSG LRTAARSKLRRQEGISRFYIIQVVFRNALEIGFLVGQYFLYGFSVPGLYECNRYPCIKEV ECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKIKLAVRGAQAKRKSVYEIRNK DLPRVSVPNFGRTQSSDSAYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnk1 (NM_008430) Mouse Tagged ORF Clone Lentiviral Particle
MR204992L4V 200 µL

Kcnk1 (NM_008430) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Caffeine
sc-202514A 100 g

Caffeine

Sign In for Pricing
View Details
Rd3 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4113803 1.0 µg DNA

Rd3 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
WS 009B
orb1703433 25 mg

WS 009B

Sign In for Pricing
View Details
Rabbit anti Goat IgG (Fc specific), conjugated with Biotin
MBS571243-01 1 mL

Rabbit anti Goat IgG (Fc specific), conjugated with Biotin

Sign In for Pricing
View Details
Rabbit anti Goat IgG (Fc specific), conjugated with Biotin
MBS571243-02 5x 1 mL

Rabbit anti Goat IgG (Fc specific), conjugated with Biotin

Sign In for Pricing
View Details