Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Protein ARV1 (ARV1)

This Recombinant Saccharomyces cerevisiae Protein ARV1 (ARV1) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Protein ARV1

UniProt

Q06541

Expression Region

1-321

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MICITCMRPVDSLYTVYSNDHIQLTDCPYCQETVDKYVEIDNVLLFIDLLLLKAGAYRHL VFNALELHLSKYPKRKALNDCQCLRDYTQALLFNVKNWFCKYDRLNRLWLLLLSFEIYLT WVTEESKYIYYLNRNNNDGKLIMLSKKLPESFKWDSAIMRNTITSKVFTWSPPIQYLYFA SYCILDVSLFHTFTQYFILKKLHWKHYSVSSKDVISYTILLSYGAKIFPILMLIWPYDTL ISMSIIKWVANLYIIESLKIVTNLSYWNIIKIFISVSLLRYFMVKPILIVFVAKFNFSVI KNLIHQEFILLLQKSGTYLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-100 1x 100 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-500 1x 500 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/2960R), CF640R conjugate, 0.1mg/mL
BNC402960-100 1x 100 µL

Desmin (Muscle Cell Marker) (DES/2960R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2953), CF405S conjugate, 0.1mg/mL
BNC042953-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2953), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details