Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelobacter propionicus Cobalamin biosynthesis protein CobD (cobD)

This Recombinant Pelobacter propionicus Cobalamin biosynthesis protein CobD (cobD) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Cobalamin biosynthesis protein CobD

UniProt

A1AMC9

Expression Region

1-323

Origin

Pelobacter propionicus (strain DSM 2379)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQPDPTVLALALLLDLCLGDPRWLPHPVVMIGRLITFLETLLRRCMANERIAGVLLLAL TVTSAASVTWLMVWGSARLHALAGLMVAALLSSTCLAARSLQRESCLVADALDAGDIASA RVKLSYIVGRDTVDLDEEEIWRALIETVAENTTDGIIAPLFWLALGGPVAGMAFKAVSTL DSMVGYKNERYLRLGWASARMDDLVNYIPARLTALLMVMVAPLIGLSQANAASIALRDRL NHPSPNSAHPESAAAGALGIRLGGPSTYGGLLSVKQFIGDPLRSIDGQAYRGMIRLMYAT TLAMAVISLATAALLRGIHVTQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

cpl-1 (Mature-region) Rabbit Polyclonal Antibody
AP54829PU-N 100 µg

cpl-1 (Mature-region) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNFAIP8 Human Gene Knockout Kit (CRISPR)
KN402729 1 Kit

TNFAIP8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ABAT (NM_000663) Human Over-expression Lysate
LY400218 100 µg

ABAT (NM_000663) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS509003 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Lysmd2 (BC048545) Mouse Tagged ORF Clone
MG200629 10 µg

Lysmd2 (BC048545) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Endo G (ENDOG) Rabbit Polyclonal Antibody
TA367044 100 µL

Endo G (ENDOG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details