Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Calcium homeostasis modulator protein 2 (CALHM2)

This Recombinant Bovine Calcium homeostasis modulator protein 2 (CALHM2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Calcium homeostasis modulator protein 2, Protein FAM26B

UniProt

Q2HJ63

Expression Region

1-323

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAALIAENFRFLSLFFKSKDVMIFNGLVALGTVGSQELFTVVAFHCPCSPARNYLYGLAA IGVPALALFLIGVILNNHTWNLVAECQYRRTKNCSAAPNFLLLSSIVGRAAVAPVTWSVI SLLRGEAYVCALSEFVNPHSLMVGERSFPVAHATEILARFPCGEGPANLSVFREEVSRRL KYESQLFGWLLIGVVAILVFLTKCLKHYCSPLSYRQEAYWAQYRANEDQLFQRTAEVHSR VLAANNVRRFFGFVALDKDDEELVAKFPVEGTQPRLQWNAITGVYLYRENQGLPLYSRLH KWAQGVVGNGMTPDHVEMSLLPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
BNC740225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF568 conjugate, 0.1mg/mL
BNC680861-500 1x 500 µL

HSP27 (G3.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-100 1x 100 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF488A conjugate, 0.1mg/mL
BNC882037-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2037), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-100 1x 100 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CGA/414), CF594 conjugate, 0.1mg/mL
BNC940414-100 1x 100 µL

Chromogranin A (CGA/414), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details