Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Germ cell-specific gene 1 protein (GSG1)

This Recombinant Bovine Germ cell-specific gene 1 protein (GSG1) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Germ cell-specific gene 1 protein

UniProt

Q3SZT1

Expression Region

1-323

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLPKGFSSQRKRLSAVLNMLSLSLSTASLLSNYWFVGTQKVPKPLCGKGLPAKCFDVPV PLDGGGTNASSPEVVHYSWETGDDRFTFHAFRSGMWLSCAEIMEEPGERCRSFLELTPPT EREILWLSLGAQFAYIGLELISFILLLTDLLFTGNPGCSLKLSAFAAISSVLSGLLGMVG HMMYSQVFQATANLGPEDWRPHAWNYGWAFYTAWVSFTCCMASAVTTFNTYTRLVLEFKC RHSKSFRGAPGCQPHHHQCFLQQLACTAHPGGPVTSYPQFHCQPIRSISEGVDFYSELHD KELQQGSSQEPETKAAGSSVEEC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-500 1x 500 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF568 conjugate, 0.1mg/mL
BNC682034-500 1x 500 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (LPFS2/2034R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TOX3 (TOX3/1123), CF640R conjugate, 0.1mg/mL
BNC401123-100 1x 100 µL

TOX3 (TOX3/1123), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2641), CF640R conjugate, 0.1mg/mL
BNC402641-100 1x 100 µL

Prolactin (Pituitary Tumor Marker) (PRL/2641), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details