Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Calcium homeostasis modulator protein 2 (Calhm2)

This Recombinant Mouse Calcium homeostasis modulator protein 2 (Calhm2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Calcium homeostasis modulator protein 2, Protein FAM26B

UniProt

Q8VEC4

Expression Region

1-323

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAALIAENFRFLSLFFKSKDVMIFNGLVALGTVGSQELFSVVAFHCPCSPARNYLYGLTA IGVPALALFLIGVILNNHTWNLVAECQYRRAKNCSAAPNFLLLSSILGRAAVAPVTWSVI SLLRGEAYVCALSEFVDPSSLTAGDKGFPPAHATEVLARFPCGEGPANLSSFREEVSRRL KYESQLFGWLLIGVVAILVFLTKCLKHYCSPLSYRQEAYWAQYRTNEDQLFQRTAEVHSR VLAANNVRRFFGFVALNKDDEELVAKFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLH KWAQGLTGNGTAPDNVEMALLTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

16S V4 Library Preparation Kit for Illumina (Set C)
70630 96 Preparations

16S V4 Library Preparation Kit for Illumina (Set C)

Sign In for Pricing
View Details
2-Vinylthiophene (Stabilized with BHT)
TRC-V756998-50MG 50 mg

2-Vinylthiophene (Stabilized with BHT)

Sign In for Pricing
View Details
TGF beta 1 Recombinant Rabbit monoclonal Antibody
HA750485 100 µL

TGF beta 1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SHARP1 (BHLHE41) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H3]
TA806407AM 100 µL

SHARP1 (BHLHE41) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H3]

Sign In for Pricing
View Details
TRH Receptor (TRHR) Rabbit Polyclonal Antibody
AP01441PU-N 100 µg

TRH Receptor (TRHR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Neurofilament A Chicken Polyclonal Antibody
CH22101-100 100 µL

Neurofilament A Chicken Polyclonal Antibody

Sign In for Pricing
View Details