Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Calcium homeostasis modulator protein 2 (Calhm2)

This Recombinant Mouse Calcium homeostasis modulator protein 2 (Calhm2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Calcium homeostasis modulator protein 2, Protein FAM26B

UniProt

Q8VEC4

Expression Region

1-323

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAALIAENFRFLSLFFKSKDVMIFNGLVALGTVGSQELFSVVAFHCPCSPARNYLYGLTA IGVPALALFLIGVILNNHTWNLVAECQYRRAKNCSAAPNFLLLSSILGRAAVAPVTWSVI SLLRGEAYVCALSEFVDPSSLTAGDKGFPPAHATEVLARFPCGEGPANLSSFREEVSRRL KYESQLFGWLLIGVVAILVFLTKCLKHYCSPLSYRQEAYWAQYRTNEDQLFQRTAEVHSR VLAANNVRRFFGFVALNKDDEELVAKFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLH KWAQGLTGNGTAPDNVEMALLTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ki-67 (Proliferating Cell Marker) (MKI67/2462), Biotin conjugate, 0.1mg/mL
BNCB2462-100 1x 100 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2462), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Macrophage Scavenger Receptor I (MSR1) (NM_002445) Human Recombinant Protein
TP312931M 100 µg

Macrophage Scavenger Receptor I (MSR1) (NM_002445) Human Recombinant Protein

Sign In for Pricing
View Details
FNBP3 (PRPF40A) Rabbit Polyclonal Antibody
TA370773 100 µL

FNBP3 (PRPF40A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL3RB Polyclonal Antibody
E-AB-13273-01 20 µL

IL3RB Polyclonal Antibody

Sign In for Pricing
View Details
IL3RB Polyclonal Antibody
E-AB-13273-02 60 µL

IL3RB Polyclonal Antibody

Sign In for Pricing
View Details
IL3RB Polyclonal Antibody
E-AB-13273-03 120 µL

IL3RB Polyclonal Antibody

Sign In for Pricing
View Details