Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gallid herpesvirus 2 Glycoprotein K (MDV067)

This Recombinant Gallid herpesvirus 2 Glycoprotein K (MDV067) spans the amino acid sequence from region 32-354.

Product Specifications

Product Name Alternative

Glycoprotein K, gK

UniProt

Q9E6M3

Expression Region

32-354

Origin

Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QNGSGCIYATLVDSSLYDAKNFTWEQYNSTLIYTALGNKLPLDGGFDDFSDVCRTYLVNL TSISGLASHVSTKPKIRSVVGTRNCVTYLWRIHIQSLSSSLGLYTIFYVIREWRRMFGVV RFEDDAISTARYTKNYAARVISSVLLNTTYTKMSRFMCEIMIYKNALSRTFKDDPISFLF HHPIAAVLIITEGLVRLGAQCLCLATLSMYFVPCEKVLSKWFLSITGIFIGIIICIELSL LLAPGPVDGAAMLGETKQVKKDECALETSPSGVHVFCSNCCASLISNILIKVLYILFMII LIVTIVRYERTLQIALFGRAYLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
BNC471081-100 1x 100 µL

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
BNC680177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
BNC940679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-100 1x 100 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (LAMP4/824), CF640R conjugate, 0.1mg/mL
BNC400824-100 1x 100 µL

CD68 (LAMP4/824), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details