Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus halodurans ComG operon protein 2 homolog (comGB)

This Recombinant Bacillus halodurans ComG operon protein 2 homolog (comGB) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

ComG operon protein 2 homolog

UniProt

Q9K920

Expression Region

1-323

Origin

Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEQGYHLYEAVQFLAIHAPSSAQKKMNAMLMDLRSGYPLHKALDHLQLPQDVQLLLYVS ERNGDLAQGFRKSGELFKKREEMKRKWEGAMRYPLLLIIVTLLLMFILMYFVLPHHQTLY RSLQIELPVITKLVIACSEKLPWLFTAFFVVAILLVLTYFVTFHRFPPTKKVTVLLRIPG LSQWTKEVITCLFCLTLGGLLKGGLSIMEALSICKEQDFFLFFRSEGEEMMLELENGERL YECLRRRPHYLKELPFVVENGEKTGNLAKDLLYFSDYQLEEFERRVKKWLVAIQPIVFSM IGAVILVLFLAMMLPVFQMIGAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-500 1x 500 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-100 1x 100 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
BNC940181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-100 1x 100 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details