Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc transporter 2 (SLC30A2)

This Recombinant Human Zinc transporter 2 (SLC30A2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Zinc transporter 2, ZnT-2, Solute carrier family 30 member 2

UniProt

Q9BRI3

Expression Region

1-323

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAKEKQHLLDARPAIRSYTGSLWQEGAGWIPLPRPGLDLQAIELAAQSNHHCHAQKGPD SHCDPKKGKAQRQLYVASAICLLFMIGEVVEILGALVSVLSIWVVTGVLVYLAVERLISG DYEIDGGTMLITSGCAVAVNIIMGLTLHQSGHGHSHGTTNQQEENPSVRAAFIHVIGDFM QSMGVLVAAYILYFKPEYKYVDPICTFVFSILVLGTTLTILRDVILVLMEGTPKGVDFTA VRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHT VTIQIEDYSEDMKDCQACQGPSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAX Polyclonal Antibody
E-AB-67898-01 60 µL

BAX Polyclonal Antibody

Sign In for Pricing
View Details
BAX Polyclonal Antibody
E-AB-67898-02 120 µL

BAX Polyclonal Antibody

Sign In for Pricing
View Details
BAX Polyclonal Antibody
E-AB-67898-03 200 µL

BAX Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB510505 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
Platelet Incubator BINC-701
BINC-701 1 Unit

Platelet Incubator BINC-701

Sign In for Pricing
View Details
tert-Butyl 6'-Chloro-1',2'-dihydrospiro[azetidine-3,3'-indole]-1-carboxylate
TRC-B448595-250MG 250 mg

tert-Butyl 6'-Chloro-1',2'-dihydrospiro[azetidine-3,3'-indole]-1-carboxylate

Sign In for Pricing
View Details