Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc transporter 2 (SLC30A2)

This Recombinant Human Zinc transporter 2 (SLC30A2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Zinc transporter 2, ZnT-2, Solute carrier family 30 member 2

UniProt

Q9BRI3

Expression Region

1-323

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAKEKQHLLDARPAIRSYTGSLWQEGAGWIPLPRPGLDLQAIELAAQSNHHCHAQKGPD SHCDPKKGKAQRQLYVASAICLLFMIGEVVEILGALVSVLSIWVVTGVLVYLAVERLISG DYEIDGGTMLITSGCAVAVNIIMGLTLHQSGHGHSHGTTNQQEENPSVRAAFIHVIGDFM QSMGVLVAAYILYFKPEYKYVDPICTFVFSILVLGTTLTILRDVILVLMEGTPKGVDFTA VRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHT VTIQIEDYSEDMKDCQACQGPSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLMO2 (PRELID3B) Human Gene Knockout Kit (CRISPR)
KN401029 1 Kit

SLMO2 (PRELID3B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EBP50 (SLC9A3R1) Rabbit Monoclonal Antibody
TA422882 100 µL

EBP50 (SLC9A3R1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Tnp1 (NM_009407) Mouse Tagged ORF Clone
MG200020 10 µg

Tnp1 (NM_009407) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Smad3 Recombinant Rabbit Monoclonal Antibody [SY25-01]
ET1607-41 100 µL

Smad3 Recombinant Rabbit Monoclonal Antibody [SY25-01]

Sign In for Pricing
View Details
Cy3B maleimide
942-AAT 1 mg

Cy3B maleimide

Sign In for Pricing
View Details
SLAMF8 Human Gene Knockout Kit (CRISPR)
KN416603 1 Kit

SLAMF8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details