Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calcium homeostasis modulator protein 2 (CALHM2)

This Recombinant Human Calcium homeostasis modulator protein 2 (CALHM2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Calcium homeostasis modulator protein 2, Protein FAM26B

UniProt

Q9HA72

Expression Region

1-323

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAALIAENFRFLSLFFKSKDVMIFNGLVALGTVGSQELFSVVAFHCPCSPARNYLYGLAA IGVPALVLFIIGIILNNHTWNLVAECQHRRTKNCSAAPTFLLLSSILGRAAVAPVTWSVI SLLRGEAYVCALSEFVDPSSLTAREEHFPSAHATEILARFPCKENPDNLSDFREEVSRRL RYESQLFGWLLIGVVAILVFLTKCLKHYCSPLSYRQEAYWAQYRANEDQLFQRTAEVHSR VLAANNVRRFFGFVALNKDDEELIANFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLH KWAQGLAGNGAAPDNVEMALLPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 Polyclonal Antibody, Cy5.5 Conjugated
bs-10218R-Cy5.5 100 µL

CD5 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Mterfd3 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7418403 1.0 µg DNA

Mterfd3 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
DNAAF11 Antibody
orb1316676 100 µL

DNAAF11 Antibody

Sign In for Pricing
View Details
Rat Shank1 Pre-designed siRNA Set B
SI212810B 1 Each

Rat Shank1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
COPS8 siRNA (Mouse)
orb1838340-01 15 nmol

COPS8 siRNA (Mouse)

Sign In for Pricing
View Details
COPS8 siRNA (Mouse)
orb1838340-02 30 nmol

COPS8 siRNA (Mouse)

Sign In for Pricing
View Details