Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calcium homeostasis modulator protein 2 (CALHM2)

This Recombinant Human Calcium homeostasis modulator protein 2 (CALHM2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Calcium homeostasis modulator protein 2, Protein FAM26B

UniProt

Q9HA72

Expression Region

1-323

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAALIAENFRFLSLFFKSKDVMIFNGLVALGTVGSQELFSVVAFHCPCSPARNYLYGLAA IGVPALVLFIIGIILNNHTWNLVAECQHRRTKNCSAAPTFLLLSSILGRAAVAPVTWSVI SLLRGEAYVCALSEFVDPSSLTAREEHFPSAHATEILARFPCKENPDNLSDFREEVSRRL RYESQLFGWLLIGVVAILVFLTKCLKHYCSPLSYRQEAYWAQYRANEDQLFQRTAEVHSR VLAANNVRRFFGFVALNKDDEELIANFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLH KWAQGLAGNGAAPDNVEMALLPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR87/95 Polyclonal Antibody
orb311357-01 50 μL

GPR87/95 Polyclonal Antibody

Sign In for Pricing
View Details
GPR87/95 Polyclonal Antibody
orb311357-02 100 µL

GPR87/95 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse CXCL2/ MIP-2 Protein, His, E.coli-200ug
QP8651-ec-200ug 200ug

Recombinant Mouse CXCL2/ MIP-2 Protein, His, E.coli-200ug

Sign In for Pricing
View Details
MAChR M1 (G-9)
sc-365966 200 µg/mL

MAChR M1 (G-9)

Sign In for Pricing
View Details
NNOS (Neuronal Nitric Oxide Synthase) (FITC)
301423-FITC 100 µL

NNOS (Neuronal Nitric Oxide Synthase) (FITC)

Sign In for Pricing
View Details
B4GALT4 (NM_003778) Human Recombinant Protein
TP309493M 100 µg

B4GALT4 (NM_003778) Human Recombinant Protein

Sign In for Pricing
View Details