Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calcium homeostasis modulator protein 2 (CALHM2)

This Recombinant Human Calcium homeostasis modulator protein 2 (CALHM2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Calcium homeostasis modulator protein 2, Protein FAM26B

UniProt

Q9HA72

Expression Region

1-323

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAALIAENFRFLSLFFKSKDVMIFNGLVALGTVGSQELFSVVAFHCPCSPARNYLYGLAA IGVPALVLFIIGIILNNHTWNLVAECQHRRTKNCSAAPTFLLLSSILGRAAVAPVTWSVI SLLRGEAYVCALSEFVDPSSLTAREEHFPSAHATEILARFPCKENPDNLSDFREEVSRRL RYESQLFGWLLIGVVAILVFLTKCLKHYCSPLSYRQEAYWAQYRANEDQLFQRTAEVHSR VLAANNVRRFFGFVALNKDDEELIANFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLH KWAQGLAGNGAAPDNVEMALLPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC16A Polyclonal Antibody, APC-Cy7 Conjugated
bs-18539R-APC-Cy7 100 µL

CLEC16A Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Mouse Platelet Factor 4 Variant 1 ELISA Kit
MBS721523-01 48 Well

Mouse Platelet Factor 4 Variant 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Platelet Factor 4 Variant 1 ELISA Kit
MBS721523-02 96 Well

Mouse Platelet Factor 4 Variant 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Platelet Factor 4 Variant 1 ELISA Kit
MBS721523-03 5x 96 Well

Mouse Platelet Factor 4 Variant 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Platelet Factor 4 Variant 1 ELISA Kit
MBS721523-04 10x 96 Well

Mouse Platelet Factor 4 Variant 1 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human IFNα2 Protein (Trx Tag)
PDEH101119-01 20 µg

Recombinant Human IFNα2 Protein (Trx Tag)

Sign In for Pricing
View Details