Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Voltage-dependent calcium channel gamma-2 subunit (CACNG2)

This Recombinant Human Voltage-dependent calcium channel gamma-2 subunit (CACNG2) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

Voltage-dependent calcium channel gamma-2 subunit, Neuronal voltage-gated calcium channel gamma-2 subunit, Transmembrane AMPAR regulatory protein gamma-2, TARP gamma-2

UniProt

Q9Y698

Expression Region

1-323

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS SRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH NCIQKENKDSLHSNTANRRTTPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-100 1x 100 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL/597), CF740 conjugate, 0.1mg/mL
BNC740597-100 1x 100 µL

Alkaline Phosphatase (ALPL/597), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF640R conjugate, 0.1mg/mL
BNC400385-100 1x 100 µL

CD3e (Rabbit PAb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF488A conjugate, 0.1mg/mL
BNC882557-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-2 (SUMO2/1199), CF594 conjugate, 0.1mg/mL
BNC941199-100 1x 100 µL

SUMO-2 (SUMO2/1199), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details