Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Germ cell-specific gene 1 protein (Gsg1)

This Recombinant Mouse Germ cell-specific gene 1 protein (Gsg1) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Germ cell-specific gene 1 protein, Germ cell-associated protein 1

UniProt

Q8R1W2

Expression Region

1-324

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKMEFQKGSSDQRTFISAILNMLSLGLSTASLLSSEWFVGTQKVPKPLCGQSLAAKCFD MPMSLDGGIANTSAQEVVQYTWETGDDRFSFLAFRSGMWLSCEETMEEPGEKCRRFIELT PPAQRWLSLGAQTAYIGLQLISFLLLLTDLLLTTNPGCGLKLSAFAAVSLVLSGLLGMVA HMLYSQVFQATANLGPEDWRPHSWNYGWAFYTAWVSFTCCMASAVTTFNMYTRMVLEFKC RHSKSFNTNPSCLAQHHRCFLPPPLTCTTHAGEPLSSCHQYPSHPIRSVSEAIDLYSALQ DKEFQQGISQELKEVVEPSVEEQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIAO1 Rabbit Polyclonal Antibody
TA374800 100 µL

CIAO1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS705709 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: 6F12]
AM02112PU-S 10 µg

Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: 6F12]

Sign In for Pricing
View Details
Glycine max Gel -SBA- Immobilized Lectin
A-1301-2 2 mL

Glycine max Gel -SBA- Immobilized Lectin

Sign In for Pricing
View Details
Human STK32A activation kit by CRISPRa
GA116420 1 Kit

Human STK32A activation kit by CRISPRa

Sign In for Pricing
View Details
Cplx2 Mouse Gene Knockout Kit (CRISPR)
KN503756 1 Kit

Cplx2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details