Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Germ cell-specific gene 1 protein (Gsg1)

This Recombinant Mouse Germ cell-specific gene 1 protein (Gsg1) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Germ cell-specific gene 1 protein, Germ cell-associated protein 1

UniProt

Q8R1W2

Expression Region

1-324

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKMEFQKGSSDQRTFISAILNMLSLGLSTASLLSSEWFVGTQKVPKPLCGQSLAAKCFD MPMSLDGGIANTSAQEVVQYTWETGDDRFSFLAFRSGMWLSCEETMEEPGEKCRRFIELT PPAQRWLSLGAQTAYIGLQLISFLLLLTDLLLTTNPGCGLKLSAFAAVSLVLSGLLGMVA HMLYSQVFQATANLGPEDWRPHSWNYGWAFYTAWVSFTCCMASAVTTFNMYTRMVLEFKC RHSKSFNTNPSCLAQHHRCFLPPPLTCTTHAGEPLSSCHQYPSHPIRSVSEAIDLYSALQ DKEFQQGISQELKEVVEPSVEEQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD66 (CEA) (COL-1), Biotin conjugate, 0.1mg/mL
BNCB0002-100 1x 100 µL

CD66 (CEA) (COL-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR4D1 Human Gene Knockout Kit (CRISPR)
KN417627 1 Kit

OR4D1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CPXM (CPXM1) activation kit by CRISPRa
GA111172 1 Kit

Human CPXM (CPXM1) activation kit by CRISPRa

Sign In for Pricing
View Details
Human KLLN activation kit by CRISPRa
GA119187 1 Kit

Human KLLN activation kit by CRISPRa

Sign In for Pricing
View Details
Biotin Conjugated Vicia faba Lectin (Fava Bean) -VFA-
BA-4801-1 1 mg

Biotin Conjugated Vicia faba Lectin (Fava Bean) -VFA-

Sign In for Pricing
View Details
MRGPRF (NM_001098515) Human Over-expression Lysate
LC426018 20 µg

MRGPRF (NM_001098515) Human Over-expression Lysate

Sign In for Pricing
View Details