Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kluyveromyces lactis Palmitoyltransferase PFA3 (PFA3)

This Recombinant Kluyveromyces lactis Palmitoyltransferase PFA3 (PFA3) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Palmitoyltransferase PFA3, EC= 2.3.1.-, Protein fatty acyltransferase 3

UniProt

Q6CPU8

Expression Region

1-325

Origin

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLDRIGFYFPKALSNFLILYTCCICFSRIDILPRIVNVVLLITLSSFALYTYWKIIRVG AGSPLEYSFLKIQSIDNVLNRTEQPPDIIKDNCIFVKRDGSFRFCQTCEIWKPDRCHHCS KCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVLLMTSAQLYSWFRQMKYK SELLDLHLLVVWVLSVIAAIATFAFTTYTIWLVTKNETTIEQYEWGNIRHDLEIYGDSIN CNMGSVDNVFDLGSRSANFNCVMGASWAELLLPIQVRADDPFDPYANQGLFFPVQSDTYR IYRESVNLQQRLITRLTLRPSIEHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-100 1x 100 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
BNC400266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-100 1x 100 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details