Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psittacid herpesvirus 1 Glycoprotein K (UL53)

This Recombinant Psittacid herpesvirus 1 Glycoprotein K (UL53) spans the amino acid sequence from region 34-358.

Product Specifications

Product Name Alternative

Glycoprotein K, gK, Syncytial protein

UniProt

Q6UDM3

Expression Region

34-358

Origin

Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) (PsHV-1) (Pacheco's disease virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NNEDCVYATRSLAAQVQLGELGANMSTETRLRIRGAAAEPVSVGPFNRSLVYVINSDASL LYSPRETQDGRCFANTFHKTDMAAVMKVYPDGKNVVLVLEMADCMAYLWFFQVRTATAAL LMYLAFLCVNRQRRGFGPWLDSASRVSAEAYYLNYWTTLAARVFLKVRYLKLSRFLREIE YRREQTWRQFSIDTLGFYLMHPLALLLRAIETILYFASLVASATVLRVNFDPCSVVLPNH VKVFAWVFVAALGALEVVSAIDHLRRETRSARDAAAVIRPTNIIAACCANIISHVLLRML YGAALVLVVIGALKYEREIQTRLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF488A conjugate, 0.1mg/mL
BNC881052-500 1x 500 µL

CD3e (B-B12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL
BNC471073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF568 conjugate, 0.1mg/mL
BNC682818-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details