Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sideroflexin-3 (SFXN3)

This Recombinant Human Sideroflexin-3 (SFXN3) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Sideroflexin-3

UniProt

Q9BWM7

Expression Region

1-325

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAG VVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTV VFWQWVNQSFNAIVNYSNRSGDTPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVG RFVPFAAVAAANCINIPLMRQRELQVGIPVADEAGQRLGYSVTAAKQGIFQVVISRICMA IPAMAIPPLIMDTLEKKDFLKRRPWLGAPLQVGLVGFCLVFATPLCCALFPQKSSIHISN LEPELRAQIHEQNPSVEVVYYNKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Artery: peripheral
CS630287 5x 5 µm

Frozen Tissue Sections, Artery: peripheral

Sign In for Pricing
View Details
MYLK2 (NM_033118) Human Recombinant Protein
TP313583 20 µg

MYLK2 (NM_033118) Human Recombinant Protein

Sign In for Pricing
View Details
FEN1 Mouse Monoclonal Antibody [A1B12]
HA600025 100 µL

FEN1 Mouse Monoclonal Antibody [A1B12]

Sign In for Pricing
View Details
Crystallin Alpha B (CPTC-CRYAB-1), CF594 conjugate, 0.1mg/mL
BNC942235-100 1x 100 µL

Crystallin Alpha B (CPTC-CRYAB-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS710271 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), CF647 conjugate, 0.1mg/mL
BNC470828-500 1x 500 µL

CD79a (JCB117 + HM47/A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details