Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Triose phosphate/phosphate translocator, chloroplastic (TPT)

This Recombinant Triose phosphate/phosphate translocator, chloroplastic (TPT) spans the amino acid sequence from region 83-408.

Product Specifications

Product Name Alternative

Triose phosphate/phosphate translocator, chloroplastic, cTPT

UniProt

P49131

Expression Region

83-408

Origin

Flaveria pringlei

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATASDSAGDAAPVGFFAKYPFLVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSAIHL AVGVVYCLGGWAVGLPKRAPMDSNLLKLLIPVAFCHALGHVTSNVSFAAVAVSFTHTIKS LEPFFNAAASQFILGQSIPITLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNISFTY RSIYSKKAMTDMDSTNLYAYISIISLLFCIPPAIILEGPQLLKHGFSDAIAKVGMTKFIS DLFWVGMFYHLYNQLAINTLERVAPLTHAVGNVLKRVFVIGFSIIVFGNKISTQTAIGTS IAIAGVAVYSLIKAKIEEEKRGLKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human C15orf39 Protein
E30P9992 20 µg

Recombinant Human C15orf39 Protein

Sign In for Pricing
View Details
RNASEH1 Antibody
23-796 100 µL

RNASEH1 Antibody

Sign In for Pricing
View Details
(4- (Benzyloxy) -3,5-difluorophenyl) methanol
PC1009481-01 250 mg

(4- (Benzyloxy) -3,5-difluorophenyl) methanol

Sign In for Pricing
View Details
(4- (Benzyloxy) -3,5-difluorophenyl) methanol
PC1009481-02 500 mg

(4- (Benzyloxy) -3,5-difluorophenyl) methanol

Sign In for Pricing
View Details
(4- (Benzyloxy) -3,5-difluorophenyl) methanol
PC1009481-03 1 g

(4- (Benzyloxy) -3,5-difluorophenyl) methanol

Sign In for Pricing
View Details
Vmn1r22 (NM_134178) Mouse Tagged ORF Clone Lentiviral Particle
MR225093L3V 200 µL

Vmn1r22 (NM_134178) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details