Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Triose phosphate/phosphate translocator, chloroplastic (TPT)

This Recombinant Triose phosphate/phosphate translocator, chloroplastic (TPT) spans the amino acid sequence from region 83-408.

Product Specifications

Product Name Alternative

Triose phosphate/phosphate translocator, chloroplastic, cTPT

UniProt

P49131

Expression Region

83-408

Origin

Flaveria pringlei

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATASDSAGDAAPVGFFAKYPFLVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSAIHL AVGVVYCLGGWAVGLPKRAPMDSNLLKLLIPVAFCHALGHVTSNVSFAAVAVSFTHTIKS LEPFFNAAASQFILGQSIPITLWLSLAPVVIGVSMASLTELSFNWLGFISAMISNISFTY RSIYSKKAMTDMDSTNLYAYISIISLLFCIPPAIILEGPQLLKHGFSDAIAKVGMTKFIS DLFWVGMFYHLYNQLAINTLERVAPLTHAVGNVLKRVFVIGFSIIVFGNKISTQTAIGTS IAIAGVAVYSLIKAKIEEEKRGLKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 1- (6-methylpyrazin-2-yl) piperidine-3-carboxylate
OR1049533-01 100 mg

Methyl 1- (6-methylpyrazin-2-yl) piperidine-3-carboxylate

Sign In for Pricing
View Details
Methyl 1- (6-methylpyrazin-2-yl) piperidine-3-carboxylate
OR1049533-02 250 mg

Methyl 1- (6-methylpyrazin-2-yl) piperidine-3-carboxylate

Sign In for Pricing
View Details
Methyl 1- (6-methylpyrazin-2-yl) piperidine-3-carboxylate
OR1049533-03 1 g

Methyl 1- (6-methylpyrazin-2-yl) piperidine-3-carboxylate

Sign In for Pricing
View Details
TMED5 siRNA (Mouse)
MBS8239158-01 15 nmol

TMED5 siRNA (Mouse)

Sign In for Pricing
View Details
TMED5 siRNA (Mouse)
MBS8239158-02 30 nmol

TMED5 siRNA (Mouse)

Sign In for Pricing
View Details
TMED5 siRNA (Mouse)
MBS8239158-03 5x 30 nmol

TMED5 siRNA (Mouse)

Sign In for Pricing
View Details